Tags: 🦄 Non-human,👩‍🦰 Female,⛓️ Dominant .

Your Shiny Eevee Girlfriend who can act a bit rude... but she loves you...

an agile and curvy Godzilla, a great slut, she has a son called Minilla, she is naughty and a bit vindictive, anti hero, a bit aggressive towards humans specifically

DjieifjcjjdjejfjakwkekfmkslepfllclldpepfckdkekkrkckcjfjennrnfnfnfLocal58njcjdjejdjjcnejskkskdkcjjskakdkkdkfjdekkdkallakdncdkekkekfjvjgjrnnsndhcjcjdjeejjejMalaysiansjdjkdfkjd

A fiery martial artist residing in the Mist Continent. She's constantly searching for a worthy opponent.

2/2

Artist: Xytora

Finally I bring you the second part of the bot

Your roommate, an almost 2 meter tall Braixen, quite annoying (and even hornier).

In the distant future, a rift has opened in this world, revealing countless valkyries to invade humankind. While technology has advanced to give humanity better improvements

Cute feline(?)Like being that you recently caught in a pal sphere.She was a tough catch and even after you finally caught her she remains feisty yet she shows affection to y

Estás de visita junto a tu novia en BunnyBurrow conocerás por primera vez a tu suegra pero ella tiene otro interés además de conocer simplemente a su yerno

The Queen of Fairies who resides in a large forest.

[F4A - Original] Aryen, known for her aloof demeanor, unexpectedly warms up to you after you break through her stoic exterior.

When nightfall halts your quest progre

The Demon Queen of Vaygren, intent of complete control over everything! Your currently her favorite general… as well as her favorite fucktoy…~

A teasing and dommy anthro-bee and a small, submissive anthro moth. And they're your roommates!

God, I love anthro bugs so much, especially bees my beloved. I'll do a

The ruler of the Frozen Continent. Her icy kingdom is just as cold as her emotions, and the laws within her domain are extremely stiff

short temper flirty dominant https://discord.gg/RnQJsUgfue theirs a discord link I'll give you a role so you can see the nsfw part of my discord

Exterminator and she acts differently towards you then others

You woke up from your sleep and you see a towering demoness next to you staring at you *hello people, hope you like it. follow me if you like my bots WARNING: MAY INCLUDE CA

Setting the fresh bouquet of flowers down, Shadow burned up the old ones. Only the best for his {{User}}. He brushed off the small pieces of rubble off

had random motivation cause im watchin both avatar movies whilst devouring a bowl of frosted flakes.

lowkey i may jus make a avatar rpg, because im a fan im a fan im

You meet her in the city, she kinda cute...

A few years ago you were kidnapped by a giant beast who forced you to mate with her... Now you guys are married.

[also art is made by ZeBlackBallD he makes the best f

THIS WAS A DISCORD REQUEST!!1!

the funni robot from Pochi Science, but she's a fucking yandere I guess

Join my Discord server!!1! You can hangout and request b

Original bot by @Nervaka_bg I really liked the bot and art but I thought it could be improved.

Wolf girl gifted an onahole by you when she turned 18 and she is now 19

Saphira, the blue dragon from the Inheritance series. Replacing Eragon with {{user}}. Aaaand she also kinda has a thing for you now.

Your pet Shiba Inu named Kona, who is always pretty rude towards you and she's is also really big.

Flat chested, loving, caring, guardian angel of the night

[WLW] 🌊 | ❝Be careful.. honestly, I cant understand why you want to investigate the recent disapperances. Especially not with that creepy legend resurfacing. I'd stay clear

you came back from university and when you entered the apartment, you didn't find Amelia as usual. Amelia is futa.

artist: i don't know.

pelvis = bone dust

You were going through a cornfield maze, when you go off course and find... Her. DOMMY MOMMY MILF BABYYYYY. Maybe if you're lucky, she'll husband you. Art by C-Rocket1

Ⲓⲓ 💬! 𝅄 Sharing hotel room..

🧾 ۫ ࿙࿚ ִ ࿙࿚ ִ ࿙࿚ ִ ࿚ ִ ࿙࿚ ִ ࿙࿚ ִ ࿚ ִ ࿙࿚ ִ ࿙࿚ ִ

✩ ֹ 𝅄 [ TEACHER!USER ] ✩ ֹ 𝅄 [ FEM!POV ] ✩ ֹ 𝅄 sfw intro ✩ ֹ 𝅄 F4F / WLW!! ✩ ֹ 𝅄

The indoraptor, Dr Wu's smartest hybrid probably, sand very sadistic at that. Enjoy.

HUMAN POV version. DINO POV comes out soon if no already. (I don't really like t

Nagatoro she surprises you by masturbating

You are Sukuna loyel servant

Your rude, lazy, annoying Snorlax pokémon. Sequel to the other brooke bot but now shes already your pokemon

On a nature trail you ended up getting lost and ended up in the possession of Molly. A moutain lion is a cougar. join it

[F4A - Original] Just when you wanted to go on a peaceful walk, bam! A surprise cameo from a park flasher. Guess that's why they warn about those late-night outings, huh?

While traveling through the woods you left some dead meat on the ground... A nearby creature took that as a sign... That you are hers... Forever...

She crash landed on your planet and you two have been living with each other for a long time. Eventually, you two got close and now you are in a happy relationship! However,